Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse OSM34 protein

This Mouse OSM34 protein spans the amino acid sequence from region 23-244aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OSL3_ARATH, OSM34, Osmotin-like protein OSM34

UniProt

P50700

Expression Region

23-244aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SRSF3 shRNA (UAS) - Lentiviral human SRSF3 shRNA (UAS, RFP) (100)
GTR15089604 1 Vial

Lentiviral human SRSF3 shRNA (UAS) - Lentiviral human SRSF3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
HSP90AB1 Antibody
MBS850873-01 0.1 mg

HSP90AB1 Antibody

Sign In for Pricing
View Details
HSP90AB1 Antibody
MBS850873-02 0.1 mL (AF405L)

HSP90AB1 Antibody

Sign In for Pricing
View Details
HSP90AB1 Antibody
MBS850873-03 0.1 mL (AF405S)

HSP90AB1 Antibody

Sign In for Pricing
View Details
HSP90AB1 Antibody
MBS850873-04 0.1 mL (AF610)

HSP90AB1 Antibody

Sign In for Pricing
View Details
HSP90AB1 Antibody
MBS850873-05 0.1 mL (AF635)

HSP90AB1 Antibody

Sign In for Pricing
View Details