Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse OSM34 protein

This Mouse OSM34 protein spans the amino acid sequence from region 23-244aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OSL3_ARATH, OSM34, Osmotin-like protein OSM34

UniProt

P50700

Expression Region

23-244aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAQR5 Recombinant Protein (Mouse)
RP160106 100 µg

PAQR5 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
KRT32 Rabbit pAb, PE-Cy5 conjugated
orb2858999 100 µL

KRT32 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
NUP50 Antibody
orb1730872 100 µL

NUP50 Antibody

Sign In for Pricing
View Details
TUBE1 ORF Vector (Human) (pORF)
ORF011157 1.0 µg DNA

TUBE1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Probable C->U-editing Enzyme APO-BEC-2 (APO-BEC2) Bovine ELISA Kit
G1025 96 Tests

Probable C->U-editing Enzyme APO-BEC-2 (APO-BEC2) Bovine ELISA Kit

Sign In for Pricing
View Details
5- (((4-Bromo-2,5-dimethoxyphenyl) amino) methylene) -2,2-dimethyl-1,3-dioxane-4,6-dione
FB169470 5000 mg

5- (((4-Bromo-2,5-dimethoxyphenyl) amino) methylene) -2,2-dimethyl-1,3-dioxane-4,6-dione

Sign In for Pricing
View Details