Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant LOLPIB protein

This Plant LOLPIB protein spans the amino acid sequence from region 26-307aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Lol p Ib Allergen Lol p Va Allergen, Lol p 5a

UniProt

Q40240

Expression Region

26-307aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Lolium perenne

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Fluoro-4-oxo-1,4-dihydroquinoline-3-carboxylic Acid
TRC-F597838-500MG 500 mg

6-Fluoro-4-oxo-1,4-dihydroquinoline-3-carboxylic Acid

Sign In for Pricing
View Details
CD47 Mouse Monoclonal Antibody [Clone ID: OTI1C11]
CF813264 100 µg

CD47 Mouse Monoclonal Antibody [Clone ID: OTI1C11]

Sign In for Pricing
View Details
Recombinant Vimentin Antibody
RC-3066-01 50 μL

Recombinant Vimentin Antibody

Sign In for Pricing
View Details
Recombinant Vimentin Antibody
RC-3066-02 100 µL

Recombinant Vimentin Antibody

Sign In for Pricing
View Details
Recombinant Vimentin Antibody
RC-3066-03 1 mL

Recombinant Vimentin Antibody

Sign In for Pricing
View Details
ZNF394 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E4]
TA808958BM 100 µL

ZNF394 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E4]

Sign In for Pricing
View Details