Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pf4 protein

This Mouse Pf4 protein spans the amino acid sequence from region 30-105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 4

UniProt

Q9Z126

Expression Region

30-105aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant IBV Hemagglutinin / HA0 Protein (aa 1-584) [His]
VAng-Wyb7101-50g 50 µg

Recombinant IBV Hemagglutinin / HA0 Protein (aa 1-584) [His]

Sign In for Pricing
View Details
CNOT7 (CCR4-NOT Transcription Complex Subunit 7, BTG1-binding Factor 1, CCR4-associated Factor 1, CAF-1, CAF1) (Biotin)
MBS6141272-01 0.1 mL

CNOT7 (CCR4-NOT Transcription Complex Subunit 7, BTG1-binding Factor 1, CCR4-associated Factor 1, CAF-1, CAF1) (Biotin)

Sign In for Pricing
View Details
CNOT7 (CCR4-NOT Transcription Complex Subunit 7, BTG1-binding Factor 1, CCR4-associated Factor 1, CAF-1, CAF1) (Biotin)
MBS6141272-02 5x 0.1 mL

CNOT7 (CCR4-NOT Transcription Complex Subunit 7, BTG1-binding Factor 1, CCR4-associated Factor 1, CAF-1, CAF1) (Biotin)

Sign In for Pricing
View Details
BAK/BAK1 Rabbit Polyclonal Antibody (Fluoro647)
orb3083106 100 µg

BAK/BAK1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Leishmania peptide 183
MBS5789594 Inquire

Leishmania peptide 183

Sign In for Pricing
View Details
NNT-1/BSF-3 siRNA (m)
sc-39686 10 µM

NNT-1/BSF-3 siRNA (m)

Sign In for Pricing
View Details