Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pf4 protein

This Mouse Pf4 protein spans the amino acid sequence from region 30-105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 4

UniProt

Q9Z126

Expression Region

30-105aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calbindin Antibody
MBS9436113-01 0.05 mL

Calbindin Antibody

Sign In for Pricing
View Details
Calbindin Antibody
MBS9436113-02 0.1 mL

Calbindin Antibody

Sign In for Pricing
View Details
Calbindin Antibody
MBS9436113-03 5x 0.1 mL

Calbindin Antibody

Sign In for Pricing
View Details
CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034)
125415 100 µg

CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034)

Sign In for Pricing
View Details
Human Desmocollin 3 (DSC3) ELISA Kit
RDR-DSC3-Hu-48Tests 48 Tests

Human Desmocollin 3 (DSC3) ELISA Kit

Sign In for Pricing
View Details
RNU6-39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1852808 1.0 µg DNA

RNU6-39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details