Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse MSRB7 protein

This Mouse MSRB7 protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peptide-methionine (R) -S-oxide reductase

UniProt

Q8VY86

Expression Region

1-144aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal MAdCAM-1 Antibody (RM0284-11A55) [Biotin]
NBP2-11785B 0.1 mL

Rat Monoclonal MAdCAM-1 Antibody (RM0284-11A55) [Biotin]

Sign In for Pricing
View Details
TCP11L2 CRISPR Activation Plasmid (h)
sc-415220-ACT 20 µg

TCP11L2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
RING1 (Ring Finger Protein 1, Ring1A, RNF1) (FITC)
251129-FITC 100 µL

RING1 (Ring Finger Protein 1, Ring1A, RNF1) (FITC)

Sign In for Pricing
View Details
PIBF1 Rabbit pAb
E45R25105N-100 100 µL

PIBF1 Rabbit pAb

Sign In for Pricing
View Details
STX11 discontinued
395021 200 µL

STX11 discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal CPLX3 Antibody [mFluor Violet 500 SE]
NBP3-00305MFV500 0.1 mL

Rabbit Polyclonal CPLX3 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details