Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse MSRB7 protein

This Mouse MSRB7 protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peptide-methionine (R) -S-oxide reductase

UniProt

Q8VY86

Expression Region

1-144aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kif21b ORF Vector (Mouse) (pORF)
ORF048568 1.0 µg DNA

Kif21b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ANKRD11 Polyclonal Antibody, FITC Conjugated
bs-7961R-FITC-01 20 µL

ANKRD11 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
ANKRD11 Polyclonal Antibody, FITC Conjugated
bs-7961R-FITC-02 100 µL

ANKRD11 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
nephrocystin-2 CRISPR/Cas9 KO Plasmid (h)
sc-403310 20 µg

nephrocystin-2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
MSI1 ORF Vector (Human) (pORF)
30737011 1.0 µg DNA

MSI1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PREX1 Antibody
OAGA07275-100UL 100 µL

PREX1 Antibody

Sign In for Pricing
View Details