Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse MSRB7 protein

This Mouse MSRB7 protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peptide-methionine (R) -S-oxide reductase

UniProt

Q8VY86

Expression Region

1-144aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem132b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6066806 1.0 µg DNA

Tmem132b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal MMP-9 Antibody (S51-82) [Biotin]
NBP2-59699B 100 µL

Mouse Monoclonal MMP-9 Antibody (S51-82) [Biotin]

Sign In for Pricing
View Details
CD34 Human, Sf9
32-13103-2 2 µg

CD34 Human, Sf9

Sign In for Pricing
View Details
FastScan™ Total Stat6 ELISA Kit
CST 69530C 1 Kit

FastScan™ Total Stat6 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Syap1 shRNA (UAS) - Lentiviral mouseSyap1 shRNA (UAS, GFP) (25)
GTR15206900 1 Vial

Lentiviral mouse Syap1 shRNA (UAS) - Lentiviral mouseSyap1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FMNL1 Rabbit Polyclonal Antibody
E10G01385 100 µL

FMNL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details