Mouse HDT2 protein
This Mouse HDT2 protein spans the amino acid sequence from region 1-306aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
HD-tuins protein 2 Histone deacetylase 2b
UniProt
Q56WH4
Expression Region
1-306aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Arabidopsis thaliana (Mouse-ear cress)
Field of Research
Developmental Biology, Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-tagged Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS710952-01 0.1 mL
Rabbit anti-human prolylcarboxypeptidase (angiotensinase C) polyclonal Antibody
Sign In for Pricing
View Details MBS710952-02 5x 0.1 mL
Rabbit anti-human prolylcarboxypeptidase (angiotensinase C) polyclonal Antibody
Sign In for Pricing
View Details 
MBS157572-03 5x 0.1 mg
Recombinant Mouse Cfap299 protein, C-His Tag
Sign In for Pricing
View Details AC-100-16-10 0.5 mL
Anti-Mouse IgG (H+L), Rat Serum Adsorbed - 100nm Gold Conjugate
Sign In for Pricing
View Details