Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse HDT2 protein

This Mouse HDT2 protein spans the amino acid sequence from region 1-306aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HD-tuins protein 2 Histone deacetylase 2b

UniProt

Q56WH4

Expression Region

1-306aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Developmental Biology, Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PDCD5/TFAR19 Protein (N-6His)
MBS2553063-01 0.01 mg

Recombinant Human PDCD5/TFAR19 Protein (N-6His)

Sign In for Pricing
View Details
Recombinant Human PDCD5/TFAR19 Protein (N-6His)
MBS2553063-02 0.05 mg

Recombinant Human PDCD5/TFAR19 Protein (N-6His)

Sign In for Pricing
View Details
Recombinant Human PDCD5/TFAR19 Protein (N-6His)
MBS2553063-03 5x 0.05 mg

Recombinant Human PDCD5/TFAR19 Protein (N-6His)

Sign In for Pricing
View Details
ABO Antibody
orb1410598-01 20 µg

ABO Antibody

Sign In for Pricing
View Details
ABO Antibody
orb1410598-02 100 µg

ABO Antibody

Sign In for Pricing
View Details
ABO Antibody
orb1410598-03 200 µg

ABO Antibody

Sign In for Pricing
View Details