Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pig GPX5 protein

This Pig GPX5 protein spans the amino acid sequence from region 22-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymis-specific glutathione peroxidase-like protein Short name, EGLP

UniProt

O18994

Expression Region

22-219aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurogenin 2 Rabbit Polyclonal Antibody (PE-Cy7)
orb900685 100 µL

Neurogenin 2 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Csrp2bp siRNA Oligos set (Rat)
16968176 3x 5 nmol

Csrp2bp siRNA Oligos set (Rat)

Sign In for Pricing
View Details
FOXL1 Polyclonal Antibody
orb3149848-01 50 µg

FOXL1 Polyclonal Antibody

Sign In for Pricing
View Details
FOXL1 Polyclonal Antibody
orb3149848-02 100 µg

FOXL1 Polyclonal Antibody

Sign In for Pricing
View Details
RGP1 Antibody
OAPB00667-100UG 0.1 mg

RGP1 Antibody

Sign In for Pricing
View Details
Mageb5 Mouse Gene Knockout Kit (CRISPR)
KN509666 1 Kit

Mageb5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details