What is the catalog number for Pig GPX5 protein?

The catalog number for Pig GPX5 protein is orb383352.

What sizes are available for Pig GPX5 protein?

Pig GPX5 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Pig GPX5 protein come in?

Pig GPX5 protein is available in 3 different pack sizes.

Is Pig GPX5 protein in stock?

Pig GPX5 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Pig GPX5 protein

This Pig GPX5 protein spans the amino acid sequence from region 22-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymis-specific glutathione peroxidase-like protein Short name, EGLP

UniProt

O18994

Expression Region

22-219aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE