Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf15 protein

This Mouse Fgf15 protein spans the amino acid sequence from region 26-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, FGF-15

UniProt

O35622

Expression Region

26-218aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KIDINS220 Recombinant Protein (N-His)
HD508012-01 50 µg

Human KIDINS220 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human KIDINS220 Recombinant Protein (N-His)
HD508012-02 100 µg

Human KIDINS220 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human KIDINS220 Recombinant Protein (N-His)
HD508012-03 1 mg

Human KIDINS220 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Recombinant Psychromonas ingrahamii Autonomous glycyl radical cofactor (grcA)
MBS1035368-01 0.02 mg (E-Coli)

Recombinant Psychromonas ingrahamii Autonomous glycyl radical cofactor (grcA)

Sign In for Pricing
View Details
Recombinant Psychromonas ingrahamii Autonomous glycyl radical cofactor (grcA)
MBS1035368-02 0.1 mg (E-Coli)

Recombinant Psychromonas ingrahamii Autonomous glycyl radical cofactor (grcA)

Sign In for Pricing
View Details
Recombinant Psychromonas ingrahamii Autonomous glycyl radical cofactor (grcA)
MBS1035368-03 0.02 mg (Yeast)

Recombinant Psychromonas ingrahamii Autonomous glycyl radical cofactor (grcA)

Sign In for Pricing
View Details