Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse NDK1 protein

This Mouse NDK1 protein spans the amino acid sequence from region 1-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleoside diphosphate kinase I Short name, NDK I Short name, NDP kinase I Short name, NDPK I

UniProt

P39207

Expression Region

1-149aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Alpha-1-Acid Glycoprotein ELISA Kit
MBS105934-01 48 Well

Hamster Alpha-1-Acid Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Hamster Alpha-1-Acid Glycoprotein ELISA Kit
MBS105934-02 96 Well

Hamster Alpha-1-Acid Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Hamster Alpha-1-Acid Glycoprotein ELISA Kit
MBS105934-03 5x 96 Well

Hamster Alpha-1-Acid Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Hamster Alpha-1-Acid Glycoprotein ELISA Kit
MBS105934-04 10x 96 Well

Hamster Alpha-1-Acid Glycoprotein ELISA Kit

Sign In for Pricing
View Details
CNPY2 Antibody
CSB-PA005675GA01HU 100 µL

CNPY2 Antibody

Sign In for Pricing
View Details
SRPK1 Rabbit Polyclonal Antibody (Biotin)
orb2095954 100 µL

SRPK1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details