Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse NDK1 protein

This Mouse NDK1 protein spans the amino acid sequence from region 1-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleoside diphosphate kinase I Short name, NDK I Short name, NDP kinase I Short name, NDPK I

UniProt

P39207

Expression Region

1-149aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL3 beta Rabbit Polyclonal Antibody (Biotin)
orb451150 100 µL

IL3 beta Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit IGF-1 ELISA Kit (DIY Antibody Pairs)
orb2702555 5 Plate

Rabbit IGF-1 ELISA Kit (DIY Antibody Pairs)

Sign In for Pricing
View Details
NDUFA4 Protein Vector (Human) (pPB-N-His)
PV103959 500 ng

NDUFA4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
BRD4 Rabbit Polyclonal Antibody
orb574904 100 µL

BRD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P38 (phospho Tyr182) Polyclonal Antibody
orb1415332 100 µL

P38 (phospho Tyr182) Polyclonal Antibody

Sign In for Pricing
View Details
Toll-Like Receptor 4 (TLR4) Horse ELISA Kit
H6692 96 Tests

Toll-Like Receptor 4 (TLR4) Horse ELISA Kit

Sign In for Pricing
View Details