Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Perlwapin protein

This Animal Perlwapin protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Perlwapin

UniProt

P84811

Expression Region

1-134aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Haliotis laevigata (Smooth Australian abalone)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YGPNLPGCPPGPYPRICARYCHSDRECKAGYYCCNTGCLNICVPKPKPGLCPAIRPGPCKGNVCSNDQDCPGNQKCCGKPGCRRCYRPEKPGSCPPRKYDAGVCVIYCVGDFDCPGNEKCCGSCPRRCEKPCFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK1 Rabbit Polyclonal Antibody
AP08098PU-S 50 µL

CDK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), Biotin conjugate, 0.1mg/mL
BNCB1692-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SNX7 (NM_015976) Human Over-expression Lysate
LC432249 20 µg

SNX7 (NM_015976) Human Over-expression Lysate

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/2927), CF405S conjugate, 0.1mg/mL
BNC042927-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/2927), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TSPYL6 (NM_001003937) Human Over-expression Lysate
LY424038 100 µg

TSPYL6 (NM_001003937) Human Over-expression Lysate

Sign In for Pricing
View Details
ANKH (NM_054027) Human Over-expression Lysate
LC403292 20 µg

ANKH (NM_054027) Human Over-expression Lysate

Sign In for Pricing
View Details