What is the catalog number for Bacterial hasA protein?

The catalog number for Bacterial hasA protein is orb383331.

What sizes are available for Bacterial hasA protein?

Bacterial hasA protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial hasA protein come in?

Bacterial hasA protein is available in 3 different pack sizes.

Is Bacterial hasA protein in stock?

Bacterial hasA protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial hasA protein

This Bacterial hasA protein spans the amino acid sequence from region 1-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heme acquisition system protein A

UniProt

Q54450

Expression Region

1-188aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Serratia marcescens

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA