Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial hasA protein

This Bacterial hasA protein spans the amino acid sequence from region 1-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heme acquisition system protein A

UniProt

Q54450

Expression Region

1-188aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Serratia marcescens

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH2 rabbit pAb Antibody
orb769156-01 50 μL

MSH2 rabbit pAb Antibody

Sign In for Pricing
View Details
MSH2 rabbit pAb Antibody
orb769156-02 100 µL

MSH2 rabbit pAb Antibody

Sign In for Pricing
View Details
PTCHD1 Rabbit Polyclonal Antibody (BF680)
orb2467877 100 µL

PTCHD1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Olfr1309 3'UTR GFP Stable Cell Line
TU164815 1.0 mL

Olfr1309 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Thyroxine ELISA Kit (Rabbit)
OKCA00230-96W 96 Well

Thyroxine ELISA Kit (Rabbit)

Sign In for Pricing
View Details
Gcat Mouse siRNA Oligo Duplex (Locus ID 26912)
SR413802 1 Kit

Gcat Mouse siRNA Oligo Duplex (Locus ID 26912)

Sign In for Pricing
View Details