Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse BAS1 protein

This Mouse BAS1 protein spans the amino acid sequence from region 66-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thiol-specific antioxidant protein A

UniProt

Q96291

Expression Region

66-266aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit
orb780588-01 48 Tests

Mouse Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit

Sign In for Pricing
View Details
Mouse Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit
orb780588-02 96 Tests

Mouse Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Synapsin-1 Protein (Trx Tag)
MBS2580743-01 0.02 mg

Recombinant Mouse Synapsin-1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Synapsin-1 Protein (Trx Tag)
MBS2580743-02 0.1 mg

Recombinant Mouse Synapsin-1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Synapsin-1 Protein (Trx Tag)
MBS2580743-03 5x 0.1 mg

Recombinant Mouse Synapsin-1 Protein (Trx Tag)

Sign In for Pricing
View Details
Dengue NS1
den-004 100µg

Dengue NS1

Sign In for Pricing
View Details