Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Npm1 protein

This Mouse Npm1 protein spans the amino acid sequence from region 1-292aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleolar phosphoprotein B23 Nucleolar protein NO38 Numatrin

UniProt

Q61937

Expression Region

1-292aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VASP (pS238) Blocking Peptide
MBS8244161-01 1 mg

VASP (pS238) Blocking Peptide

Sign In for Pricing
View Details
VASP (pS238) Blocking Peptide
MBS8244161-02 5 mg

VASP (pS238) Blocking Peptide

Sign In for Pricing
View Details
VASP (pS238) Blocking Peptide
MBS8244161-03 5x 5 mg

VASP (pS238) Blocking Peptide

Sign In for Pricing
View Details
SRPK1 Antibody
orb2675014-01 50 µL

SRPK1 Antibody

Sign In for Pricing
View Details
SRPK1 Antibody
orb2675014-02 100 µL

SRPK1 Antibody

Sign In for Pricing
View Details
SRPK1 Antibody
orb2675014-03 200 µL

SRPK1 Antibody

Sign In for Pricing
View Details