E. coli rpsB protein
This E. coli rpsB protein spans the amino acid sequence from region 1-241aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
RpsB, UTI89_C0183, 30S ribosomal protein S2
UniProt
Q1RG21
Expression Region
1-241aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Escherichia coli (strain UTI89 / UPEC)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
46.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEAE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
131283 50 µg
Phosphofructokinase, Liver (PFKL, 6-phosphofructokinase Liver Type, DKFZp686G1648, DKFZp686L2097, FLJ30173, FLJ40909, Phosphofructo-1-kinase Isozyme B, PFK-B, Phosphofructokinase 1, Phosphohexokinase)
Sign In for Pricing
View Details 
MBS1099635-01 0.02 mg (E-Coli)
Recombinant Bacillus cereus subsp. cytotoxis NADH-quinone oxidoreductase subunit D (nuoD)
Sign In for Pricing
View Details MBS1099635-02 0.02 mg (Yeast)
Recombinant Bacillus cereus subsp. cytotoxis NADH-quinone oxidoreductase subunit D (nuoD)
Sign In for Pricing
View Details