Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial 30 kDa neutral phosphatase protein

This Bacterial 30 kDa neutral phosphatase protein spans the amino acid sequence from region 1-35aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, NPTase

UniProt

P21222

Expression Region

1-35aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Parvalbumin Antibody
75-455 100 µL

Anti-Parvalbumin Antibody

Sign In for Pricing
View Details
CD3G Protein Lysate (Human) with C-Ha Tag
15540031 100 µg

CD3G Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MAP3K7 Antibody
orb674540-01 50 µg

MAP3K7 Antibody

Sign In for Pricing
View Details
MAP3K7 Antibody
orb674540-02 100 µg

MAP3K7 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal LRRC41 Antibody
NBP2-14200 0.1 mL

Rabbit Polyclonal LRRC41 Antibody

Sign In for Pricing
View Details
Smad4 Blocking Peptide
MBS9616952-01 1 mg

Smad4 Blocking Peptide

Sign In for Pricing
View Details