Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial 30 kDa neutral phosphatase protein

This Bacterial 30 kDa neutral phosphatase protein spans the amino acid sequence from region 1-35aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, NPTase

UniProt

P21222

Expression Region

1-35aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNPLA2 Peptide - middle region
MBS3246324-01 0.1 mg

PNPLA2 Peptide - middle region

Sign In for Pricing
View Details
PNPLA2 Peptide - middle region
MBS3246324-02 5x 0.1 mg

PNPLA2 Peptide - middle region

Sign In for Pricing
View Details
MHC Class 1 (MHC Class I) (MaxLight 550)
M3885-48Q-ML550 100 µL

MHC Class 1 (MHC Class I) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Mouse IL-1beta
BL10028_R-01 0.005 mg

Recombinant Mouse IL-1beta

Sign In for Pricing
View Details
Recombinant Mouse IL-1beta
BL10028_R-02 0.01 mg

Recombinant Mouse IL-1beta

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Amino-acid acetyltransferase (argA)
MBS1398951-01 0.02 mg (E-Coli)

Recombinant Pseudomonas fluorescens Amino-acid acetyltransferase (argA)

Sign In for Pricing
View Details