Human CD35 protein

Anti C3 binding proteinprotein, anti C3b/C4b receptorprotein, anti C3BRprotein, anti C4BRprotein, anti CD 35protein, anti CD35protein, anti CD35 antigenprotein, anti complement component (3b/4b) receptor 1 (Knops blood group) protein, anti complement component (3b/4b) receptor 1 including Knops blood group systemprotein, anti Complement component receptor 1protein, anti Complement receptor 1protein, anti Complement receptor type 1protein, anti CR 1protein, anti CR1protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII