Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial omcA protein

This Bacterial omcA protein spans the amino acid sequence from region 19-88aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

9KDA cysteine-rich lipoprotein Short name, 9KDA-CRP

UniProt

P0CC05

Expression Region

19-88aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Chlamydia trachomatis (strain D/UW-3/Cx)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGA/FGB/FGG Antibody
orb1249888 0.25 mg

FGA/FGB/FGG Antibody

Sign In for Pricing
View Details
Sheep Kallikrein 5 ELISA Kit
MBS754608-01 48 Well

Sheep Kallikrein 5 ELISA Kit

Sign In for Pricing
View Details
Sheep Kallikrein 5 ELISA Kit
MBS754608-02 96 Well

Sheep Kallikrein 5 ELISA Kit

Sign In for Pricing
View Details
Sheep Kallikrein 5 ELISA Kit
MBS754608-03 5x 96 Well

Sheep Kallikrein 5 ELISA Kit

Sign In for Pricing
View Details
Sheep Kallikrein 5 ELISA Kit
MBS754608-04 10x 96 Well

Sheep Kallikrein 5 ELISA Kit

Sign In for Pricing
View Details
Rat Thromboxane B1 ELISA Kit
MBS7279280-01 48 Well

Rat Thromboxane B1 ELISA Kit

Sign In for Pricing
View Details