Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial mrkA protein

This Bacterial mrkA protein spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MrkAFimbrial subunit type 3

UniProt

P12267

Expression Region

23-202aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Klebsiella pneumoniae

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Chymase(Cma1), partial
AP70174-01 20 µg

Recombinant Mouse Chymase(Cma1), partial

Sign In for Pricing
View Details
Recombinant Mouse Chymase(Cma1), partial
AP70174-02 100 µg

Recombinant Mouse Chymase(Cma1), partial

Sign In for Pricing
View Details
Recombinant Mouse Chymase(Cma1), partial
AP70174-03 1 mg

Recombinant Mouse Chymase(Cma1), partial

Sign In for Pricing
View Details
ELAPOR2 (NM_001291991) Human Tagged ORF Clone
RG239565 10 µg

ELAPOR2 (NM_001291991) Human Tagged ORF Clone

Sign In for Pricing
View Details
PDE6Aα CRISPR Activation Plasmid (h2)
sc-408759-ACT-2 20 µg

PDE6Aα CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Acbd6 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7569903 1.0 µg DNA

Acbd6 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details