Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial mrkA protein

This Bacterial mrkA protein spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MrkAFimbrial subunit type 3

UniProt

P12267

Expression Region

23-202aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Klebsiella pneumoniae

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK17B / DRAK2 (1-372, His-tag) Human Protein
AR50715PU-N 100 µg

STK17B / DRAK2 (1-372, His-tag) Human Protein

Sign In for Pricing
View Details
Rhpn1 siRNA Oligos set (Mouse)
39568174 3x 5 nmol

Rhpn1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
MMP28 Antibody
CSB-PA789328-01 50 μL

MMP28 Antibody

Sign In for Pricing
View Details
MMP28 Antibody
CSB-PA789328-02 100 µL

MMP28 Antibody

Sign In for Pricing
View Details
HiQuat D 905
CO224-1X6NO 1 unit

HiQuat D 905

Sign In for Pricing
View Details
Recombinant Bacillus licheniformis Prolipoprotein diacylglyceryl transferase (lgt), partial
MBS7085358 Inquire

Recombinant Bacillus licheniformis Prolipoprotein diacylglyceryl transferase (lgt), partial

Sign In for Pricing
View Details