Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial mrkA protein

This Bacterial mrkA protein spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MrkAFimbrial subunit type 3

UniProt

P12267

Expression Region

23-202aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Klebsiella pneumoniae

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat VGF Nerve Growth Factor Inducible (VGF) ELISA Kit
DLR-VGF-Ra-01 48 Tests

Rat VGF Nerve Growth Factor Inducible (VGF) ELISA Kit

Sign In for Pricing
View Details
Rat VGF Nerve Growth Factor Inducible (VGF) ELISA Kit
DLR-VGF-Ra-02 96 Tests

Rat VGF Nerve Growth Factor Inducible (VGF) ELISA Kit

Sign In for Pricing
View Details
Ncoa2 sgRNA CRISPR Lentivector set (Mouse)
K3409001 3x 1.0 µg

Ncoa2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Indole-3-Carboxylic Acid For Biochemistry
109090 1 1 g

Indole-3-Carboxylic Acid For Biochemistry

Sign In for Pricing
View Details
Olfr142 ORF Vector (Mouse) (pORF)
ORF052326 1.0 µg DNA

Olfr142 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human RHEBL1 knockout cell line
ABC-KH12935 1 Vial

Human RHEBL1 knockout cell line

Sign In for Pricing
View Details