Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Efhd2 protein

This Mouse Efhd2 protein spans the amino acid sequence from region 2-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Swiprosin-1

UniProt

Q9D8Y0

Expression Region

2-240aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATDELASKLSRRLQMEGEGGEATEQPGLNGAAAAAAAEAPDETAQALGSADDELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLQVLARLSEIDVSTEGVKGAKNFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEVKQRKAAFKELQSTFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP9A Rabbit Polyclonal Antibody
E28PN8675 100 µL

ATP9A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CNTN4/AXCAM Rabbit Polyclonal Antibody (PE)
orb498295 100 µL

CNTN4/AXCAM Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ITGB4 3'UTR Luciferase Stable Cell Line
TU011339 1.0 mL

ITGB4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
IFNA2 Protein (C-human IgG1-Fc, Human)
P525468 100 µg

IFNA2 Protein (C-human IgG1-Fc, Human)

Sign In for Pricing
View Details
Compound NP-022458
T128618-01 10 mg

Compound NP-022458

Sign In for Pricing
View Details
Compound NP-022458
T128618-02 1 g

Compound NP-022458

Sign In for Pricing
View Details