Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial clfA protein

This Bacterial clfA protein spans the amino acid sequence from region 228-558aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen receptor A Fibrinogen-binding protein A

UniProt

Q6GB45

Expression Region

228-558aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP5 CRISPR Activation Plasmid (m)
sc-422388-ACT 20 µg

PP5 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse Anti-Bovine IgG Antibody (H+L), AbBy Fluor™ 647 Conjugated
bs-0326M-BF647 200 µL

Mouse Anti-Bovine IgG Antibody (H+L), AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 (strain TW14359/EHEC) CHEZ Polyclonal Antibody
MBS7179394 Inquire

Rabbit anti-Escherichia coli O157:H7 (strain TW14359/EHEC) CHEZ Polyclonal Antibody

Sign In for Pricing
View Details
CD19 (B Lymphocyte Antigen CD19, B4, Differentiation Antigen CD19, Leu 12, Leu-12, MGC12802) (AP) discontinued
171494-AP 100 µL

CD19 (B Lymphocyte Antigen CD19, B4, Differentiation Antigen CD19, Leu 12, Leu-12, MGC12802) (AP) discontinued

Sign In for Pricing
View Details
Acth (1-4) acetate (19405-50-6 free base)
T20482L-01 1 mg

Acth (1-4) acetate (19405-50-6 free base)

Sign In for Pricing
View Details
Acth (1-4) acetate (19405-50-6 free base)
T20482L-02 5 mg

Acth (1-4) acetate (19405-50-6 free base)

Sign In for Pricing
View Details