Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Cyclomaltodextrin glucanotransferase protein

This Bacterial Cyclomaltodextrin glucanotransferase protein spans the amino acid sequence from region 608-713aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclodextrin-glycosyltransferase Short name, CGTase

UniProt

P31835

Expression Region

608-713aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bacillus macerans

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr767 CRISPR Activation Plasmid (m2)
sc-434474-ACT-2 20 µg

Olfr767 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Anti Human FSH Pab
272143 100 µg

Anti Human FSH Pab

Sign In for Pricing
View Details
Rabbit Polyclonal Hantaan Virus Glycoprotein Antibody [Biotin]
NBP2-41258B 0.1 mL

Rabbit Polyclonal Hantaan Virus Glycoprotein Antibody [Biotin]

Sign In for Pricing
View Details
CD200R2 Double Nickase Plasmid (m)
sc-435442-NIC 20 µg

CD200R2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (CD4/3026), 0.2mg/mL
BNUB3026-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (CD4/3026), 0.2mg/mL

Sign In for Pricing
View Details
4 gas tight inner doors
6100330 1 Each

4 gas tight inner doors

Sign In for Pricing
View Details