Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KRT7 protein

This Human KRT7 protein spans the amino acid sequence from region 2-469aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokeratin-7 Short name, CK-7 Keratin-7 Short name, K7 Sarcolectin Type-II keratin Kb7

UniProt

P08729

Expression Region

2-469aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163 Recombinant Rabbit mAb, BF700 conjugated
orb2978727 100 µL

CD163 Recombinant Rabbit mAb, BF700 conjugated

Sign In for Pricing
View Details
SLC12A8 (Solute Carrier Family 12 Member 8, Solute Carrier Family 12 (Potassium/Chloride Transporters), Member 8)
491839 100 µL

SLC12A8 (Solute Carrier Family 12 Member 8, Solute Carrier Family 12 (Potassium/Chloride Transporters), Member 8)

Sign In for Pricing
View Details
Anti-MAP3K12 Antibody (N377/20)
MBS1571948-01 0.1 mg

Anti-MAP3K12 Antibody (N377/20)

Sign In for Pricing
View Details
Anti-MAP3K12 Antibody (N377/20)
MBS1571948-02 1 mg

Anti-MAP3K12 Antibody (N377/20)

Sign In for Pricing
View Details
Anti-MAP3K12 Antibody (N377/20)
MBS1571948-03 5x 1 mg

Anti-MAP3K12 Antibody (N377/20)

Sign In for Pricing
View Details
CD56 (NCAM1, NCAM, Leu-19, NKH1, MSK39, NCAM120, NCAM140, NCAM180, Neural Cell Adhesion Molecule) (PE)
168707-AF-PE 100 µL

CD56 (NCAM1, NCAM, Leu-19, NKH1, MSK39, NCAM120, NCAM140, NCAM180, Neural Cell Adhesion Molecule) (PE)

Sign In for Pricing
View Details