Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HRH1 protein

This Human HRH1 protein spans the amino acid sequence from region 211-416aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, H1R Short name, HH1R

UniProt

P35367

Expression Region

211-416aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horizontal Laminar Airflow BLHZ-205
BLHZ-205 Each

Horizontal Laminar Airflow BLHZ-205

Sign In for Pricing
View Details
Phosphoric Acid Ammonium Salt (1:1)
TRC-P359150-500G 500 g

Phosphoric Acid Ammonium Salt (1:1)

Sign In for Pricing
View Details
4-Hydroxy-3-nitrophenylacetic Acid
TRC-H948685-250MG 250 mg

4-Hydroxy-3-nitrophenylacetic Acid

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560514 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
AATOM™ 647N acid
2854-AAT 10 mg

AATOM™ 647N acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS708974 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details