Human CEACAM7 protein
This Human CEACAM7 protein spans the amino acid sequence from region 36-242aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Carcinoembryonic antigen CGM2
UniProt
Q14002
Expression Region
36-242aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Disease Biomarkers
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
39.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS009852-100ug 100 µg
EPM2AIP1 (NM_014805) Human Over-expression Lysate
Sign In for Pricing
View Details 362923 200 µL
EED (Embryonic Ectoderm Development, HEED, WAIT1, WD Protein Associating With Integrin Cytoplasmic Tails 1)
Sign In for Pricing
View Details 
MBS1257772-01 0.02 mg (E-Coli)
Recombinant Staphylococcus aureus Glucosamine-6-phosphate deaminase (nagB)
Sign In for Pricing
View Details MBS1257772-02 0.1 mg (E-Coli)
Recombinant Staphylococcus aureus Glucosamine-6-phosphate deaminase (nagB)
Sign In for Pricing
View Details MBS1257772-03 0.02 mg (Yeast)
Recombinant Staphylococcus aureus Glucosamine-6-phosphate deaminase (nagB)
Sign In for Pricing
View Details