Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CEACAM7 protein

This Human CEACAM7 protein spans the amino acid sequence from region 36-242aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carcinoembryonic antigen CGM2

UniProt

Q14002

Expression Region

36-242aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX2IP Protein Vector (Mouse) (pPB-N-His)
PV234267 500 ng

SSX2IP Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Ep-CAM (CD326, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial Glycoprotein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-associated Calcium Signal Transducer 1, ECS-1,
MBS6215123-01 0.1 mL

Ep-CAM (CD326, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial Glycoprotein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-associated Calcium Signal Transducer 1, ECS-1,

Sign In for Pricing
View Details
Ep-CAM (CD326, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial Glycoprotein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-associated Calcium Signal Transducer 1, ECS-1,
MBS6215123-02 5x 0.1 mL

Ep-CAM (CD326, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial Glycoprotein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-associated Calcium Signal Transducer 1, ECS-1,

Sign In for Pricing
View Details
5-Pyridin-3-Yl-1H-Indazole
288027-01 50 mg

5-Pyridin-3-Yl-1H-Indazole

Sign In for Pricing
View Details
5-Pyridin-3-Yl-1H-Indazole
288027-02 100 mg

5-Pyridin-3-Yl-1H-Indazole

Sign In for Pricing
View Details
5-Pyridin-3-Yl-1H-Indazole
288027-03 250 mg

5-Pyridin-3-Yl-1H-Indazole

Sign In for Pricing
View Details