Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fbxw10 protein

This Mouse Fbxw10 protein spans the amino acid sequence from region 701-1030aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-box and WD-40 domain-containing protein 10

UniProt

Q5SUS0

Expression Region

701-1030aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKWQYSSDKNKVKKSKDKEEEREETSLGDEHSRSTIQGHSLKDSVSSKQEFSKSRVHLKQTKNLSSDDMETPVGEVSHPLQKLWKVPMTPDRFLLTISALQQAHNSEEFAYPHRPRPQVIDAWGPSIPYPRKVLSLKGKSVQHAVDQLRSSNLPTGVRQTNIPLEIQKLQPNLKKSLHSPRVQATVPQPSLIRPKVSDSLRGDEHLTSSIDGTMRRAGPLTSMQVIKPNRMLAPRGGTATLSPKKERPRFYTTLDPLRMNTGFMLMTVKEEKEFAEAKMKEYEASVSTKEVDPGKASKAAWIRKIKGLPIDNFMKEGKTAAPELGQNVFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIC3 Human Over-expression Lysate
orb1340822 100 µg

RIC3 Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-human nuclear transcription factor, X-box binding 1 polyclonal Antibody
MBS714222-01 0.1 mL

Rabbit anti-human nuclear transcription factor, X-box binding 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human nuclear transcription factor, X-box binding 1 polyclonal Antibody
MBS714222-02 5x 0.1 mL

Rabbit anti-human nuclear transcription factor, X-box binding 1 polyclonal Antibody

Sign In for Pricing
View Details
RPL14
CSB-CL020142HU1 10 μg Plasmid + 200 μL Glycerol

RPL14

Sign In for Pricing
View Details
CSNK1G2 Rabbit Polyclonal Antibody (Cy5)
orb920264 100 µL

CSNK1G2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Factor XIII (HRP) discontinued
F0019-50A-HRP 100 µL

Factor XIII (HRP) discontinued

Sign In for Pricing
View Details