Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fbxw10 protein

This Mouse Fbxw10 protein spans the amino acid sequence from region 701-1030aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-box and WD-40 domain-containing protein 10

UniProt

Q5SUS0

Expression Region

701-1030aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKWQYSSDKNKVKKSKDKEEEREETSLGDEHSRSTIQGHSLKDSVSSKQEFSKSRVHLKQTKNLSSDDMETPVGEVSHPLQKLWKVPMTPDRFLLTISALQQAHNSEEFAYPHRPRPQVIDAWGPSIPYPRKVLSLKGKSVQHAVDQLRSSNLPTGVRQTNIPLEIQKLQPNLKKSLHSPRVQATVPQPSLIRPKVSDSLRGDEHLTSSIDGTMRRAGPLTSMQVIKPNRMLAPRGGTATLSPKKERPRFYTTLDPLRMNTGFMLMTVKEEKEFAEAKMKEYEASVSTKEVDPGKASKAAWIRKIKGLPIDNFMKEGKTAAPELGQNVFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC2 Protein Vector (Human) (pPM-C-His)
PV134517 500 ng

TACC2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Multiplex Assay Kit for Excitatory Amino Acid Transporter 2 (EAAT2), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0030329 96 Tests

Multiplex Assay Kit for Excitatory Amino Acid Transporter 2 (EAAT2), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Rabbit Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit
MBS7222375-01 48 Well

Rabbit Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit
MBS7222375-02 96 Well

Rabbit Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit
MBS7222375-03 5x 96 Well

Rabbit Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit
MBS7222375-04 10x 96 Well

Rabbit Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit

Sign In for Pricing
View Details