Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Cyclomaltodextrin glucanotransferase protein

This Bacterial Cyclomaltodextrin glucanotransferase protein spans the amino acid sequence from region 608-713aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclodextrin-glycosyltransferase Short name, CGTase

UniProt

P31835

Expression Region

608-713aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Paenibacillus macerans (Bacillus macerans)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dracorhodin Perchlorate
TRC-D678910-25MG 25 mg

Dracorhodin Perchlorate

Sign In for Pricing
View Details
Maf Antibody
8C10174-AAT 50 µg

Maf Antibody

Sign In for Pricing
View Details
Glutathione S Transferase theta 2 (GSTT2B) Human Gene Knockout Kit (CRISPR)
KN416501 1 Kit

Glutathione S Transferase theta 2 (GSTT2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C22orf28 (RTCB) (NM_014306) Human Over-expression Lysate
LC402309 20 µg

C22orf28 (RTCB) (NM_014306) Human Over-expression Lysate

Sign In for Pricing
View Details
NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C12]
TA505967BM 100 µL

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C12]

Sign In for Pricing
View Details
Mcam Mouse Gene Knockout Kit (CRISPR)
KN309859BN 1 Kit

Mcam Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details