Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Cyclomaltodextrin glucanotransferase protein

This Bacterial Cyclomaltodextrin glucanotransferase protein spans the amino acid sequence from region 608-713aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclodextrin-glycosyltransferase Short name, CGTase

UniProt

P31835

Expression Region

608-713aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Paenibacillus macerans (Bacillus macerans)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rex1 (ZFP42) Mouse Monoclonal Antibody [Clone ID: OTI3H9]
CF807532 100 µg

Rex1 (ZFP42) Mouse Monoclonal Antibody [Clone ID: OTI3H9]

Sign In for Pricing
View Details
O-De-phenyl Ostarine
TRC-D221635-10MG 10 mg

O-De-phenyl Ostarine

Sign In for Pricing
View Details
Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF488A conjugate, 0.1mg/mL
BNC882303-100 1x 100 µL

Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human KLHL14 activation kit by CRISPRa
GA111593 1 Kit

Human KLHL14 activation kit by CRISPRa

Sign In for Pricing
View Details
3,5-Tolylenediamine
TRC-T733940-5MG 5 mg

3,5-Tolylenediamine

Sign In for Pricing
View Details
alpha Synuclein (SNCA) pTyr133 Rabbit Polyclonal Antibody
AP09477PU-S 50 µL

alpha Synuclein (SNCA) pTyr133 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details