Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD3E protein

This Human CD3E protein spans the amino acid sequence from region 23-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FLJ18683 Proteins, T3E Proteins, TCRE Proteins, CD3E Proteins, CD3-epsilon Proteins, CD3 epsilon Proteins, CD3E Proteins, CD3E antigen epsilon polypeptide (TiT3 complex) Proteins, CD3E antigen epsilon polypeptide Proteins, CD3E antigen Proteins, epsilon subunit Proteins, CD3E molecule epsilon Proteins, CD3E molecule Proteins, epsilon (CD3 TCR complex) Proteins, CD3E molecule Proteins, epsilon (CD3-TCR complex) Proteins, CD3E_HUMAN Proteins, IMD18 Proteins, T cell antigen receptor complex epsilon subunit of T3 Proteins, T cell surface antigen T3/Leu 4 epsilon chain Proteins, T cell surface glycoprotein CD3 epsilon chain Proteins, T-cell surface antigen T3/Leu-4 epsilon chain Proteins, T-cell surface glycoprotein CD3 epsilon chain Proteins, T3E Proteins, TCRE Proteins

UniProt

P07766

Expression Region

23-126aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)
MBS2107314-01 0.1 mL

FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)
MBS2107314-02 0.2 mL

FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)
MBS2107314-03 0.5 mL

FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)
MBS2107314-04 1 mL

FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)
MBS2107314-05 5 mL

FITC-Linked Polyclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
BarX2 Rabbit Polyclonal Antibody (HRP)
orb473584 100 µL

BarX2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details