Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi hfb1 protein

This Fungi hfb1 protein spans the amino acid sequence from region 23-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hydrophobin I Short name, HFBI

UniProt

P52754

Expression Region

23-97aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Hypocrea jecorina (Trichoderma reesei)

Field of Research

Infectious Disease & Virology; Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Iduronic Acid Sodium Salt
TRC-I252000-5MG 5 mg

L-Iduronic Acid Sodium Salt

Sign In for Pricing
View Details
ALKBH6 (Center) Rabbit Polyclonal Antibody
AP50151PU-N 400 µL

ALKBH6 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MPO Antibody Pair Set
E-KAB-0403 50 µL & 100 µg

Human MPO Antibody Pair Set

Sign In for Pricing
View Details
CAMK2A pThr286 Rabbit Polyclonal Antibody
AP02526PU-S 50 µL

CAMK2A pThr286 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HS6ST1 Human Gene Knockout Kit (CRISPR)
KN419550 1 Kit

HS6ST1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GFUS (NM_003313) Human Over-expression Lysate
LY418775 100 µg

GFUS (NM_003313) Human Over-expression Lysate

Sign In for Pricing
View Details