Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat S100a9 protein

This Rat S100a9 protein spans the amino acid sequence from region 2-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calgranulin-B Migration inhibitory factor-related protein 14 Short name, MRP-14 Short name, p14 Myeloid-related protein 14 S100 calcium-binding protein A9

UniProt

P50116

Expression Region

2-113aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA46 Rabbit Polyclonal Antibody
orb580251 100 µL

SPATA46 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Anti SARS-CoV-2 Spike (S2) Antibody (CH1)
MAB12447-500 1 Each

Mouse Anti SARS-CoV-2 Spike (S2) Antibody (CH1)

Sign In for Pricing
View Details
NR1I2 Antibody
DF4827-01 100 µL

NR1I2 Antibody

Sign In for Pricing
View Details
NR1I2 Antibody
DF4827-02 200 µL

NR1I2 Antibody

Sign In for Pricing
View Details
M-CSF/CSF-1 Protein, Human, Recombinant (Tag Free)
E51P00616 100 µg

M-CSF/CSF-1 Protein, Human, Recombinant (Tag Free)

Sign In for Pricing
View Details
Oncomodulin Polyclonal Antibody
bs-12154R 100 µL

Oncomodulin Polyclonal Antibody

Sign In for Pricing
View Details