Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat S100a9 protein

This Rat S100a9 protein spans the amino acid sequence from region 2-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calgranulin-B Migration inhibitory factor-related protein 14 Short name, MRP-14 Short name, p14 Myeloid-related protein 14 S100 calcium-binding protein A9

UniProt

P50116

Expression Region

2-113aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PALLD Knockout HT29 Polyclonal Cells
ARG14561 1 Million

PALLD Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
2310057N15Rik Protein Vector (Mouse) (pPB-N-His)
PV148119 500 ng

2310057N15Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
PE anti-mouse CD163 Recombinant
GT02043 100 µg

PE anti-mouse CD163 Recombinant

Sign In for Pricing
View Details
Human Dipeptidyl Peptidase IV (DPP4) ELISA Kit
orb775459-01 48 Tests

Human Dipeptidyl Peptidase IV (DPP4) ELISA Kit

Sign In for Pricing
View Details
Human Dipeptidyl Peptidase IV (DPP4) ELISA Kit
orb775459-02 96 Tests

Human Dipeptidyl Peptidase IV (DPP4) ELISA Kit

Sign In for Pricing
View Details
CCR4-NOT Transcription Complex Subunit 8 (CNOT8) Antibody
abx111459 100 µL

CCR4-NOT Transcription Complex Subunit 8 (CNOT8) Antibody

Sign In for Pricing
View Details