Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MYBPC3 protein

This Human MYBPC3 protein spans the amino acid sequence from region 1-328aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-protein, cardiac muscle isoform

UniProt

Q14896

Expression Region

1-328aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Tubulin Polymerization Promoting Protein ELISA Kit
MBS734063-01 48 Well

Sheep Tubulin Polymerization Promoting Protein ELISA Kit

Sign In for Pricing
View Details
Sheep Tubulin Polymerization Promoting Protein ELISA Kit
MBS734063-02 96 Well

Sheep Tubulin Polymerization Promoting Protein ELISA Kit

Sign In for Pricing
View Details
Sheep Tubulin Polymerization Promoting Protein ELISA Kit
MBS734063-03 5x 96 Well

Sheep Tubulin Polymerization Promoting Protein ELISA Kit

Sign In for Pricing
View Details
Sheep Tubulin Polymerization Promoting Protein ELISA Kit
MBS734063-04 10x 96 Well

Sheep Tubulin Polymerization Promoting Protein ELISA Kit

Sign In for Pricing
View Details
1-Bromododecane pure, 98%
28503 250 mL

1-Bromododecane pure, 98%

Sign In for Pricing
View Details
C-fos Rabbit Polyclonal Antibody (Cy3)
orb977197 100 µL

C-fos Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details