What is the catalog number for Human MYBPC3 protein?

The catalog number for Human MYBPC3 protein is orb383268.

What sizes are available for Human MYBPC3 protein?

Human MYBPC3 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human MYBPC3 protein come in?

Human MYBPC3 protein is available in 3 different pack sizes.

Is Human MYBPC3 protein in stock?

Human MYBPC3 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human MYBPC3 protein

This Human MYBPC3 protein spans the amino acid sequence from region 1-328aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-protein, cardiac muscle isoform

UniProt

Q14896

Expression Region

1-328aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA