Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli efp protein

This E. coli efp protein spans the amino acid sequence from region 2-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, EF-P

UniProt

P0A6N4

Expression Region

2-188aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tuba3a Mouse siRNA Oligo Duplex (Locus ID 22144)
SR414714 1 Kit

Tuba3a Mouse siRNA Oligo Duplex (Locus ID 22144)

Sign In for Pricing
View Details
Human Matrilysin (MMP7) Protein
abx656145-01 50 µg

Human Matrilysin (MMP7) Protein

Sign In for Pricing
View Details
Human Matrilysin (MMP7) Protein
abx656145-02 100 µg

Human Matrilysin (MMP7) Protein

Sign In for Pricing
View Details
Human Matrilysin (MMP7) Protein
abx656145-03 200 µg

Human Matrilysin (MMP7) Protein

Sign In for Pricing
View Details
Human Matrilysin (MMP7) Protein
abx656145-04 500 µg

Human Matrilysin (MMP7) Protein

Sign In for Pricing
View Details
Human Matrilysin (MMP7) Protein
abx656145-05 1 mg

Human Matrilysin (MMP7) Protein

Sign In for Pricing
View Details