What is the catalog number for E. coli efp protein?

The catalog number for E. coli efp protein is orb383264.

What sizes are available for E. coli efp protein?

E. coli efp protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E. coli efp protein come in?

E. coli efp protein is available in 3 different pack sizes.

Is E. coli efp protein in stock?

E. coli efp protein is currently made to order / not held in immediate stock. Contact us for lead time.

E. coli efp protein

This E. coli efp protein spans the amino acid sequence from region 2-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, EF-P

UniProt

P0A6N4

Expression Region

2-188aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK