Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tsc22d4 protein

This Mouse Tsc22d4 protein spans the amino acid sequence from region 1-387aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TSC22-related-inducible leucine zipper protein 2 Thg-1pit

UniProt

Q9EQN3

Expression Region

1-387aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGGKKKSSFQITSVTTDYEGPGSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQGLGEPYRRGRWTCVDVYERDLEPPSFGRLLEGIRGASGGTGGRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLAGPGKAKVETPPLSASPPQQRPPGPGTGDSAQTLPSLRVEVESGGSAAATPPLSRRRDGAVRLRMELVAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQENGLLRALASPEQLAQLPSSGLPRLGPSAPNGPSI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf49B (NM_001145139) Human Recombinant Protein
E45H33364M5 20 µg

CXorf49B (NM_001145139) Human Recombinant Protein

Sign In for Pricing
View Details
PIK3C3 Antibody
7891-01 0.02 mg

PIK3C3 Antibody

Sign In for Pricing
View Details
PIK3C3 Antibody
7891-02 0.1 mg

PIK3C3 Antibody

Sign In for Pricing
View Details
Tox2 ORF Vector (Mouse) (pORF)
47323014 1.0 µg DNA

Tox2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal 5-Lipoxygenase Antibody [Alexa Fluor 700]
NB110-58749AF700 0.1 mL

Rabbit Polyclonal 5-Lipoxygenase Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Anti-C14orf166/RTRAF Antibody Picoband®
A31823-2 100 µg/Vial

Anti-C14orf166/RTRAF Antibody Picoband®

Sign In for Pricing
View Details