Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli glpE protein

This E. coli glpE protein spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GlpE, EcolC_0289, Thiosulfate sulfurtransferase GlpE, EC 2.8.1.1

UniProt

B1IP41

Expression Region

1-108aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEVWQRQFPAEVAYGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFIT5 Rabbit Polyclonal Antibody (Biotin)
orb2599959 100 µg

IFIT5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
RGS18 (Regulator of G-protein Signaling 18, RGS13)
R1996-36L 100 µg

RGS18 (Regulator of G-protein Signaling 18, RGS13)

Sign In for Pricing
View Details
DIRAS1, ID (DIRAS1, GBTS1, RIG, GTP-binding protein Di-Ras1, Distinct subgroup of the Ras family member 1, Ras-related inhibitor of cell growth, Small GTP-binding tumor suppressor 1) (APC)
MBS6292191-01 0.2 mL

DIRAS1, ID (DIRAS1, GBTS1, RIG, GTP-binding protein Di-Ras1, Distinct subgroup of the Ras family member 1, Ras-related inhibitor of cell growth, Small GTP-binding tumor suppressor 1) (APC)

Sign In for Pricing
View Details
DIRAS1, ID (DIRAS1, GBTS1, RIG, GTP-binding protein Di-Ras1, Distinct subgroup of the Ras family member 1, Ras-related inhibitor of cell growth, Small GTP-binding tumor suppressor 1) (APC)
MBS6292191-02 5x 0.2 mL

DIRAS1, ID (DIRAS1, GBTS1, RIG, GTP-binding protein Di-Ras1, Distinct subgroup of the Ras family member 1, Ras-related inhibitor of cell growth, Small GTP-binding tumor suppressor 1) (APC)

Sign In for Pricing
View Details
TRV045
orb2814653-01 25 mg

TRV045

Sign In for Pricing
View Details
TRV045
orb2814653-02 50 mg

TRV045

Sign In for Pricing
View Details