Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli fur protein

This E. coli fur protein spans the amino acid sequence from region 2-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, Ferric uptake regulator

UniProt

P0A9A9

Expression Region

2-148aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clindamycin 2-palmitate sulfoxide
BKD92892-01 5 mg

Clindamycin 2-palmitate sulfoxide

Sign In for Pricing
View Details
Clindamycin 2-palmitate sulfoxide
BKD92892-02 10 mg

Clindamycin 2-palmitate sulfoxide

Sign In for Pricing
View Details
Clindamycin 2-palmitate sulfoxide
BKD92892-03 25 mg

Clindamycin 2-palmitate sulfoxide

Sign In for Pricing
View Details
Clindamycin 2-palmitate sulfoxide
BKD92892-04 50 mg

Clindamycin 2-palmitate sulfoxide

Sign In for Pricing
View Details
Clindamycin 2-palmitate sulfoxide
BKD92892-05 100 mg

Clindamycin 2-palmitate sulfoxide

Sign In for Pricing
View Details
PRCC Antibody
orb680480 100 µL

PRCC Antibody

Sign In for Pricing
View Details